Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCL17 monoclonal antibody (M02), clone 1F11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA |
More info about CCL17 monoclonal antibody (M02), clone 1F11
| Brand: | Abnova |
| Reference: | H00006361-M02 |
| Product name: | CCL17 monoclonal antibody (M02), clone 1F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCL17. |
| Clone: | 1F11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6361 |
| Gene name: | CCL17 |
| Gene alias: | A-152E5.3|ABCD-2|MGC138271|MGC138273|SCYA17|TARC |
| Gene description: | chemokine (C-C motif) ligand 17 |
| Genbank accession: | NM_002987 |
| Immunogen: | CCL17 (NP_002978, 24 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS |
| Protein accession: | NP_002978 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to CCL17 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA |
| Shipping condition: | Dry Ice |