| Brand: | Abnova |
| Reference: | H00006359-M03 |
| Product name: | CCL15 monoclonal antibody (M03), clone 3H1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCL15. |
| Clone: | 3H1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6359 |
| Gene name: | CCL15 |
| Gene alias: | HCC-2|HMRP-2B|LKN1|Lkn-1|MIP-1d|MIP-5|NCC-3|NCC3|SCYA15|SCYL3|SY15 |
| Gene description: | chemokine (C-C motif) ligand 15 |
| Genbank accession: | NM_032965 |
| Immunogen: | CCL15 (NP_116741, 25 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
| Protein accession: | NP_116741 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CCL15 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |