Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCL13 monoclonal antibody (M03), clone S2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about CCL13 monoclonal antibody (M03), clone S2
| Brand: | Abnova |
| Reference: | H00006357-M03 |
| Product name: | CCL13 monoclonal antibody (M03), clone S2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CCL13. |
| Clone: | S2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6357 |
| Gene name: | CCL13 |
| Gene alias: | CKb10|MCP-4|MGC17134|NCC-1|NCC1|SCYA13|SCYL1 |
| Gene description: | chemokine (C-C motif) ligand 13 |
| Genbank accession: | BC008621 |
| Immunogen: | CCL13 (AAH08621, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
| Protein accession: | AAH08621 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |