| Brand:  | Abnova | 
| Reference:  | H00006348-M03 | 
| Product name:  | CCL3 monoclonal antibody (M03), clone 2E9 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant CCL3. | 
| Clone:  | 2E9 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 6348 | 
| Gene name:  | CCL3 | 
| Gene alias:  | G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3 | 
| Gene description:  | chemokine (C-C motif) ligand 3 | 
| Genbank accession:  | NM_002983 | 
| Immunogen:  | CCL3 (NP_002974, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA | 
| Protein accession:  | NP_002974 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA | 
| Shipping condition:  | Dry Ice |