| Brand: | Abnova |
| Reference: | H00006348-M03 |
| Product name: | CCL3 monoclonal antibody (M03), clone 2E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCL3. |
| Clone: | 2E9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6348 |
| Gene name: | CCL3 |
| Gene alias: | G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3 |
| Gene description: | chemokine (C-C motif) ligand 3 |
| Genbank accession: | NM_002983 |
| Immunogen: | CCL3 (NP_002974, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Protein accession: | NP_002974 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |