Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCL3 monoclonal antibody (M01), clone 4E7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CCL3 monoclonal antibody (M01), clone 4E7
| Brand: | Abnova |
| Reference: | H00006348-M01 |
| Product name: | CCL3 monoclonal antibody (M01), clone 4E7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCL3. |
| Clone: | 4E7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6348 |
| Gene name: | CCL3 |
| Gene alias: | G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3 |
| Gene description: | chemokine (C-C motif) ligand 3 |
| Genbank accession: | NM_002983 |
| Immunogen: | CCL3 (NP_002974, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Protein accession: | NP_002974 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CCL3 expression in transfected 293T cell line by CCL3 monoclonal antibody (M01), clone 4E7. Lane 1: CCL3 transfected lysate(10.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | A multiplex assay to measure RNA transcripts of prostate cancer in urine.Quek SI, Ho ME, Loprieno MA, Ellis WJ, Elliott N, Liu AY. PLoS One. 2012;7(9):e45656. doi: 10.1371/journal.pone.0045656. Epub 2012 Sep 20. |