Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCL1 monoclonal antibody (M02), clone 4E4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about CCL1 monoclonal antibody (M02), clone 4E4
| Brand: | Abnova |
| Reference: | H00006346-M02 |
| Product name: | CCL1 monoclonal antibody (M02), clone 4E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCL1. |
| Clone: | 4E4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6346 |
| Gene name: | CCL1 |
| Gene alias: | I-309|P500|SCYA1|SISe|TCA3 |
| Gene description: | chemokine (C-C motif) ligand 1 |
| Genbank accession: | NM_002981 |
| Immunogen: | CCL1 (NP_002972, 24 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
| Protein accession: | NP_002972 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CCL1 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |