Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCL1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr |
More info about CCL1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00006346-D01P |
| Product name: | CCL1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CCL1 protein. |
| Gene id: | 6346 |
| Gene name: | CCL1 |
| Gene alias: | I-309|P500|SCYA1|SISe|TCA3 |
| Gene description: | chemokine (C-C motif) ligand 1 |
| Genbank accession: | NM_002981 |
| Immunogen: | CCL1 (NP_002972.1, 1 a.a. ~ 96 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
| Protein accession: | NP_002972.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CCL1 expression in transfected 293T cell line (H00006346-T01) by CCL1 MaxPab polyclonal antibody. Lane 1: CCL1 transfected lysate(11.00 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Toxin-induced RhoA activity mediates CCL1-triggered STAT signaling.Reipschlaeger S, Kubatzky K, Taromi S, Burger M, Orth J, Aktories K, Schmidt G. J Biol Chem. 2012 Feb 6. [Epub ahead of print] |