| Brand: | Abnova |
| Reference: | H00006339-M02 |
| Product name: | SCNN1D monoclonal antibody (M02), clone 2F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SCNN1D. |
| Clone: | 2F3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6339 |
| Gene name: | SCNN1D |
| Gene alias: | ENaCd|ENaCdelta|MGC149710|MGC149711|SCNED|dNaCh |
| Gene description: | sodium channel, nonvoltage-gated 1, delta |
| Genbank accession: | NM_002978 |
| Immunogen: | SCNN1D (NP_002969, 432 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CFYRLYQDLETHRLPCTSRCPRPCRESAFKLSTGTSRWPSAKSAGWTLATLGEQGLPHQSHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGS |
| Protein accession: | NP_002969 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |