Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SCN9A monoclonal antibody (M01), clone 5A11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about SCN9A monoclonal antibody (M01), clone 5A11
| Brand: | Abnova |
| Reference: | H00006335-M01 |
| Product name: | SCN9A monoclonal antibody (M01), clone 5A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SCN9A. |
| Clone: | 5A11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6335 |
| Gene name: | SCN9A |
| Gene alias: | ETHA|NE-NA|NENA|Nav1.7|PN1 |
| Gene description: | sodium channel, voltage-gated, type IX, alpha subunit |
| Genbank accession: | NM_002977 |
| Immunogen: | SCN9A (NP_002968, 269 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY |
| Protein accession: | NP_002968 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged SCN9A is approximately 10ng/ml as a capture antibody. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |