| Brand:  | Abnova | 
| Reference:  | H00006334-M04 | 
| Product name:  | SCN8A monoclonal antibody (M04), clone 4G7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant SCN8A. | 
| Clone:  | 4G7 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 6334 | 
| Gene name:  | SCN8A | 
| Gene alias:  | CerIII|MED|NaCh6|Nav1.6|PN4 | 
| Gene description:  | sodium channel, voltage gated, type VIII, alpha subunit | 
| Genbank accession:  | NM_014191 | 
| Immunogen:  | SCN8A (NP_055006, 1854 a.a. ~ 1951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT | 
| Protein accession:  | NP_055006 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.52 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunofluorescence of monoclonal antibody to SCN8A on NIH/3T3 cell. [antibody concentration 10 ug/ml] | 
| Applications:  | IF,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Na(v)1.1 localizes to axons of parvalbumin-positive inhibitory interneurons: a circuit basis for epileptic seizures in mice carrying an Scn1a gene mutation.Ogiwara I, Miyamoto H, Morita N, Atapour N, Mazaki E, Inoue I, Takeuchi T, Itohara S, Yanagawa Y, Obata K, Furuichi T, Hensch TK, Yamakawa K. J Neurosci. 2007 May 30;27(22):5903-14. |