Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SCN3A monoclonal antibody (M06), clone 2F8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SCN3A monoclonal antibody (M06), clone 2F8
| Brand: | Abnova |
| Reference: | H00006328-M06 |
| Product name: | SCN3A monoclonal antibody (M06), clone 2F8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SCN3A. |
| Clone: | 2F8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6328 |
| Gene name: | SCN3A |
| Gene alias: | KIAA1356|NAC3|Nav1.3 |
| Gene description: | sodium channel, voltage-gated, type III, alpha subunit |
| Genbank accession: | NM_006922 |
| Immunogen: | SCN3A (NP_008853, 1861 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LCESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDG |
| Protein accession: | NP_008853 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |