Brand: | Abnova |
Reference: | H00006328-M06 |
Product name: | SCN3A monoclonal antibody (M06), clone 2F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SCN3A. |
Clone: | 2F8 |
Isotype: | IgG2a Kappa |
Gene id: | 6328 |
Gene name: | SCN3A |
Gene alias: | KIAA1356|NAC3|Nav1.3 |
Gene description: | sodium channel, voltage-gated, type III, alpha subunit |
Genbank accession: | NM_006922 |
Immunogen: | SCN3A (NP_008853, 1861 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LCESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDG |
Protein accession: | NP_008853 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |