Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SERPINB3 monoclonal antibody (M01), clone 2F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about SERPINB3 monoclonal antibody (M01), clone 2F5
| Brand: | Abnova |
| Reference: | H00006317-M01 |
| Product name: | SERPINB3 monoclonal antibody (M01), clone 2F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SERPINB3. |
| Clone: | 2F5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6317 |
| Gene name: | SERPINB3 |
| Gene alias: | HsT1196|SCC|SCCA-1|SCCA-PD|SCCA1|T4-A |
| Gene description: | serpin peptidase inhibitor, clade B (ovalbumin), member 3 |
| Genbank accession: | NM_006919 |
| Immunogen: | SERPINB3 (NP_008850, 276 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP |
| Protein accession: | NP_008850 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.39 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SERPINB3 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Label-Free Cancer Markers Detection by Capacitance Biochip.Carrara S, Bhalla V, Stagni C, Benini L, Ferretti A, Valle F, Gallotta A, Ricco B, Samori B. Sens. Actuators B: Chem. (2008), doi:10.1016/j.snb.2008.09.050 |