No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00006317-D03P |
Product name: | SERPINB3 purified MaxPab rabbit polyclonal antibody (D03P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human SERPINB3 protein. |
Gene id: | 6317 |
Gene name: | SERPINB3 |
Gene alias: | HsT1196|SCC|SCCA-1|SCCA-PD|SCCA1|T4-A |
Gene description: | serpin peptidase inhibitor, clade B (ovalbumin), member 3 |
Genbank accession: | BC005224.1 |
Immunogen: | SERPINB3 (AAH05224, 1 a.a. ~ 390 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP |
Protein accession: | AAH05224 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SERPINB3 expression in transfected 293T cell line (H00006317-T03) by SERPINB3 MaxPab polyclonal antibody. Lane 1: SERPINB3 transfected lysate(42.90 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |