SERPINB3 MaxPab rabbit polyclonal antibody (D01) View larger

SERPINB3 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SERPINB3 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about SERPINB3 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00006317-D01
Product name: SERPINB3 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human SERPINB3 protein.
Gene id: 6317
Gene name: SERPINB3
Gene alias: HsT1196|SCC|SCCA-1|SCCA-PD|SCCA1|T4-A
Gene description: serpin peptidase inhibitor, clade B (ovalbumin), member 3
Genbank accession: NM_006919.1
Immunogen: SERPINB3 (NP_008850.1, 1 a.a. ~ 390 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Protein accession: NP_008850.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00006317-D01-13-15-1.jpg
Application image note: Western Blot analysis of SERPINB3 expression in transfected 293T cell line (H00006317-T04) by SERPINB3 MaxPab polyclonal antibody.

Lane 1: SERPINB3 transfected lysate(44.6 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy SERPINB3 MaxPab rabbit polyclonal antibody (D01) now

Add to cart