| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
| Brand: | Abnova |
| Reference: | H00006317-B01P |
| Product name: | SERPINB3 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SERPINB3 protein. |
| Gene id: | 6317 |
| Gene name: | SERPINB3 |
| Gene alias: | HsT1196|SCC|SCCA-1|SCCA-PD|SCCA1|T4-A |
| Gene description: | serpin peptidase inhibitor, clade B (ovalbumin), member 3 |
| Genbank accession: | NM_006919.1 |
| Immunogen: | SERPINB3 (NP_008850.1, 1 a.a. ~ 390 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP |
| Protein accession: | NP_008850.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SERPINB3 expression in transfected 293T cell line (H00006317-T01) by SERPINB3 MaxPab polyclonal antibody. Lane 1: SERPINB3 transfected lysate(42.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |