Brand: | Abnova |
Reference: | H00006310-M02 |
Product name: | ATXN1 monoclonal antibody (M02), clone 4C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATXN1. |
Clone: | 4C5 |
Isotype: | IgG2b Kappa |
Gene id: | 6310 |
Gene name: | ATXN1 |
Gene alias: | ATX1|D6S504E|SCA1 |
Gene description: | ataxin 1 |
Genbank accession: | NM_000332 |
Immunogen: | ATXN1 (NP_000323, 576 a.a. ~ 675 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSK |
Protein accession: | NP_000323 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |