View larger

SAT polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of SAT polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00006303-A01
Product name:	SAT polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant SAT.
Gene id:	6303
Gene name:	SAT1
Gene alias:	DC21\|KFSD\|SAT\|SSAT\|SSAT-1
Gene description:	spermidine/spermine N1-acetyltransferase 1
Genbank accession:	NM_002970
Immunogen:	SAT (NP_002961, 88 a.a. ~ 171 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	LLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Protein accession:	NP_002961
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human,Mouse,Rat
Application image:
Application image note:	SAT polyclonal antibody (A01), Lot # 051213JC01. Western Blot analysis of SAT expression in MCF-7.
Applications:	WB-Ce,ELISA,WB-Re
Shipping condition:	Dry Ice