| Brand: | Abnova |
| Reference: | H00006303-A01 |
| Product name: | SAT polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SAT. |
| Gene id: | 6303 |
| Gene name: | SAT1 |
| Gene alias: | DC21|KFSD|SAT|SSAT|SSAT-1 |
| Gene description: | spermidine/spermine N1-acetyltransferase 1 |
| Genbank accession: | NM_002970 |
| Immunogen: | SAT (NP_002961, 88 a.a. ~ 171 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE |
| Protein accession: | NP_002961 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | SAT polyclonal antibody (A01), Lot # 051213JC01. Western Blot analysis of SAT expression in MCF-7. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |