MAPK12 monoclonal antibody (M06), clone 1G3 View larger

MAPK12 monoclonal antibody (M06), clone 1G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPK12 monoclonal antibody (M06), clone 1G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about MAPK12 monoclonal antibody (M06), clone 1G3

Brand: Abnova
Reference: H00006300-M06
Product name: MAPK12 monoclonal antibody (M06), clone 1G3
Product description: Mouse monoclonal antibody raised against a partial recombinant MAPK12.
Clone: 1G3
Isotype: IgG1 Kappa
Gene id: 6300
Gene name: MAPK12
Gene alias: ERK3|ERK6|P38GAMMA|PRKM12|SAPK-3|SAPK3
Gene description: mitogen-activated protein kinase 12
Genbank accession: BC015741
Immunogen: MAPK12 (AAH15741, 251 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
Protein accession: AAH15741
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006300-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.61 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006300-M06-1-9-1.jpg
Application image note: MAPK12 monoclonal antibody (M06), clone 1G3 Western Blot analysis of MAPK12 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAPK12 monoclonal antibody (M06), clone 1G3 now

Add to cart