| Brand: | Abnova |
| Reference: | H00006300-M05 |
| Product name: | MAPK12 monoclonal antibody (M05), clone 1B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK12. |
| Clone: | 1B3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6300 |
| Gene name: | MAPK12 |
| Gene alias: | ERK3|ERK6|P38GAMMA|PRKM12|SAPK-3|SAPK3 |
| Gene description: | mitogen-activated protein kinase 12 |
| Genbank accession: | BC015741 |
| Immunogen: | MAPK12 (AAH15741, 251 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL |
| Protein accession: | AAH15741 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MAPK12 monoclonal antibody (M05), clone 1B3 Western Blot analysis of MAPK12 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |