Brand: | Abnova |
Reference: | H00006300-M03 |
Product name: | MAPK12 monoclonal antibody (M03), clone 1G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK12. |
Clone: | 1G4 |
Isotype: | IgG1 Kappa |
Gene id: | 6300 |
Gene name: | MAPK12 |
Gene alias: | ERK3|ERK6|P38GAMMA|PRKM12|SAPK-3|SAPK3 |
Gene description: | mitogen-activated protein kinase 12 |
Genbank accession: | BC015741 |
Immunogen: | MAPK12 (AAH15741, 251 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL |
Protein accession: | AAH15741 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to MAPK12 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |