MAPK12 MaxPab mouse polyclonal antibody (B01) View larger

MAPK12 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPK12 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MAPK12 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00006300-B01
Product name: MAPK12 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MAPK12 protein.
Gene id: 6300
Gene name: MAPK12
Gene alias: ERK3|ERK6|P38GAMMA|PRKM12|SAPK-3|SAPK3
Gene description: mitogen-activated protein kinase 12
Genbank accession: NM_002969.3
Immunogen: MAPK12 (NP_002960.2, 1 a.a. ~ 367 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
Protein accession: NP_002960.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006300-B01-13-15-1.jpg
Application image note: Western Blot analysis of MAPK12 expression in transfected 293T cell line (H00006300-T01) by MAPK12 MaxPab polyclonal antibody.

Lane 1: MAPK12 transfected lysate(40.37 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MAPK12 MaxPab mouse polyclonal antibody (B01) now

Add to cart