Brand: | Abnova |
Reference: | H00006300-A01 |
Product name: | MAPK12 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant MAPK12. |
Gene id: | 6300 |
Gene name: | MAPK12 |
Gene alias: | ERK3|ERK6|P38GAMMA|PRKM12|SAPK-3|SAPK3 |
Gene description: | mitogen-activated protein kinase 12 |
Genbank accession: | BC015741 |
Immunogen: | MAPK12 (AAH15741.1, 1 a.a. ~ 367 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL |
Protein accession: | AAH15741.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |