| Brand: | Abnova |
| Reference: | H00006297-M10 |
| Product name: | SALL2 monoclonal antibody (M10), clone 3F7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SALL2. |
| Clone: | 3F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6297 |
| Gene name: | SALL2 |
| Gene alias: | FLJ10414|FLJ55746|HSAL2|KIAA0360|ZNF795|p150(Sal2) |
| Gene description: | sal-like 2 (Drosophila) |
| Genbank accession: | BC024245 |
| Immunogen: | SALL2 (AAH24245, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHLHYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA |
| Protein accession: | AAH24245 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (47.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SALL2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 1.2 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |