SALL2 monoclonal antibody (M10), clone 3F7 View larger

SALL2 monoclonal antibody (M10), clone 3F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SALL2 monoclonal antibody (M10), clone 3F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SALL2 monoclonal antibody (M10), clone 3F7

Brand: Abnova
Reference: H00006297-M10
Product name: SALL2 monoclonal antibody (M10), clone 3F7
Product description: Mouse monoclonal antibody raised against a full length recombinant SALL2.
Clone: 3F7
Isotype: IgG2a Kappa
Gene id: 6297
Gene name: SALL2
Gene alias: FLJ10414|FLJ55746|HSAL2|KIAA0360|ZNF795|p150(Sal2)
Gene description: sal-like 2 (Drosophila)
Genbank accession: BC024245
Immunogen: SALL2 (AAH24245, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHLHYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA
Protein accession: AAH24245
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006297-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006297-M10-3-3-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SALL2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 1.2 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SALL2 monoclonal antibody (M10), clone 3F7 now

Add to cart