| Brand: | Abnova |
| Reference: | H00006291-M08 |
| Product name: | SAA4 monoclonal antibody (M08), clone 3C11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SAA4. |
| Clone: | 3C11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6291 |
| Gene name: | SAA4 |
| Gene alias: | C-SAA|CSAA |
| Gene description: | serum amyloid A4, constitutive |
| Genbank accession: | BC007026 |
| Immunogen: | SAA4 (AAH07026, 1 a.a. ~ 130 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY |
| Protein accession: | AAH07026 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.04 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of SAA4 transfected lysate using anti-SAA4 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SAA4 MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |