No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00006291-B02P |
Product name: | SAA4 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human SAA4 protein. |
Gene id: | 6291 |
Gene name: | SAA4 |
Gene alias: | C-SAA|CSAA |
Gene description: | serum amyloid A4, constitutive |
Genbank accession: | NM_006512.1 |
Immunogen: | SAA4 (NP_006503.1, 1 a.a. ~ 130 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY |
Protein accession: | NP_006503.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | SAA4 MaxPab polyclonal antibody. Western Blot analysis of SAA4 expression in human stomach. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |