| Brand: | Abnova |
| Reference: | H00006291-A01 |
| Product name: | SAA4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant SAA4. |
| Gene id: | 6291 |
| Gene name: | SAA4 |
| Gene alias: | C-SAA|CSAA |
| Gene description: | serum amyloid A4, constitutive |
| Genbank accession: | BC007026 |
| Immunogen: | SAA4 (AAH07026, 1 a.a. ~ 130 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY |
| Protein accession: | AAH07026 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Comparative proteomic profiling of plasma very-low-density and low-density lipoproteins.Sun HY, Chen SF, Lai MD, Chang TT, Chen TL, Li PY, Shieh DB, Young KC. Clin Chim Acta. 2009 Nov 27. [Epub ahead of print] |