Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00006289-D01P |
Product name: | SAA2 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human SAA2 protein. |
Gene id: | 6289 |
Gene name: | SAA2 |
Gene alias: | - |
Gene description: | serum amyloid A2 |
Genbank accession: | NM_030754 |
Immunogen: | SAA2 (NP_110381.1, 1 a.a. ~ 122 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY |
Protein accession: | NP_110381.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SAA2 expression in transfected 293T cell line (H00006289-T02) by SAA2 MaxPab polyclonal antibody. Lane 1: SAA2 transfected lysate(13.50 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Response Predictors to Calcineurin Inhibitors in Patients with Primary Membranous Nephropathy.Yu X, Cai J, Jiao X, Zhang S, Liu H, Ding X. Am J Nephrol. 2018 Apr 26;47(4):266-274 |