| Brand:  | Abnova | 
| Reference:  | H00006288-M01 | 
| Product name:  | SAA1 monoclonal antibody (M01), clone 3C11-2C1 | 
| Product description:  | Mouse monoclonal antibody raised against a full length recombinant SAA1. | 
| Clone:  | 3C11-2C1 | 
| Isotype:  | IgG2b kappa | 
| Gene id:  | 6288 | 
| Gene name:  | SAA1 | 
| Gene alias:  | MGC111216|PIG4|SAA|TP53I4 | 
| Gene description:  | serum amyloid A1 | 
| Genbank accession:  | BC007022 | 
| Immunogen:  | SAA1 (AAH07022, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY | 
| Protein accession:  | AAH07022 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (39.16 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | SAA1 monoclonal antibody (M01), clone 3C11-2C1. Western Blot analysis of SAA1 expression in human spleen. | 
| Applications:  | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |