Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SAA1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about SAA1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00006288-D01P |
| Product name: | SAA1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human SAA1 protein. |
| Gene id: | 6288 |
| Gene name: | SAA1 |
| Gene alias: | MGC111216|PIG4|SAA|TP53I4 |
| Gene description: | serum amyloid A1 |
| Genbank accession: | NM_000331.2 |
| Immunogen: | SAA1 (NP_000322.2, 1 a.a. ~ 122 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Protein accession: | NP_000322.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SAA1 expression in transfected 293T cell line (H00006288-T02) by SAA1 MaxPab polyclonal antibody. Lane 1: SAA1 transfected lysate(13.50 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Response Predictors to Calcineurin Inhibitors in Patients with Primary Membranous Nephropathy.Yu X, Cai J, Jiao X, Zhang S, Liu H, Ding X. Am J Nephrol. 2018 Apr 26;47(4):266-274 |