S100P monoclonal antibody (M12), clone 1A11 View larger

S100P monoclonal antibody (M12), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of S100P monoclonal antibody (M12), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about S100P monoclonal antibody (M12), clone 1A11

Brand: Abnova
Reference: H00006286-M12
Product name: S100P monoclonal antibody (M12), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant S100P.
Clone: 1A11
Isotype: IgG2a Kappa
Gene id: 6286
Gene name: S100P
Gene alias: MIG9
Gene description: S100 calcium binding protein P
Genbank accession: NM_005980
Immunogen: S100P (NP_005971.1, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQV
Protein accession: NP_005971.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006286-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006286-M12-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to S100P on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy S100P monoclonal antibody (M12), clone 1A11 now

Add to cart