Brand: | Abnova |
Reference: | H00006286-M12 |
Product name: | S100P monoclonal antibody (M12), clone 1A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant S100P. |
Clone: | 1A11 |
Isotype: | IgG2a Kappa |
Gene id: | 6286 |
Gene name: | S100P |
Gene alias: | MIG9 |
Gene description: | S100 calcium binding protein P |
Genbank accession: | NM_005980 |
Immunogen: | S100P (NP_005971.1, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQV |
Protein accession: | NP_005971.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to S100P on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |