S100P monoclonal antibody (M02A), clone 4E7 View larger

S100P monoclonal antibody (M02A), clone 4E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of S100P monoclonal antibody (M02A), clone 4E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about S100P monoclonal antibody (M02A), clone 4E7

Brand: Abnova
Reference: H00006286-M02A
Product name: S100P monoclonal antibody (M02A), clone 4E7
Product description: Mouse monoclonal antibody raised against a full-length recombinant S100P.
Clone: 4E7
Isotype: IgG2b Kappa
Gene id: 6286
Gene name: S100P
Gene alias: MIG9
Gene description: S100 calcium binding protein P
Genbank accession: BC006819
Immunogen: S100P (AAH06819, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Protein accession: AAH06819
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006286-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy S100P monoclonal antibody (M02A), clone 4E7 now

Add to cart