Brand: | Abnova |
Reference: | H00006286-M02A |
Product name: | S100P monoclonal antibody (M02A), clone 4E7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant S100P. |
Clone: | 4E7 |
Isotype: | IgG2b Kappa |
Gene id: | 6286 |
Gene name: | S100P |
Gene alias: | MIG9 |
Gene description: | S100 calcium binding protein P |
Genbank accession: | BC006819 |
Immunogen: | S100P (AAH06819, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK |
Protein accession: | AAH06819 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |