| Brand: | Abnova |
| Reference: | H00006286-M02 |
| Product name: | S100P monoclonal antibody (M02), clone 4E7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant S100P. |
| Clone: | 4E7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6286 |
| Gene name: | S100P |
| Gene alias: | MIG9 |
| Gene description: | S100 calcium binding protein P |
| Genbank accession: | BC006819 |
| Immunogen: | S100P (AAH06819, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK |
| Protein accession: | AAH06819 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged S100P is approximately 3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |