Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of S100B monoclonal antibody (M52), clone 2A10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about S100B monoclonal antibody (M52), clone 2A10
| Brand: | Abnova |
| Reference: | H00006285-M52 |
| Product name: | S100B monoclonal antibody (M52), clone 2A10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant S100B. |
| Clone: | 2A10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6285 |
| Gene name: | S100B |
| Gene alias: | NEF|S100|S100beta |
| Gene description: | S100 calcium binding protein B |
| Genbank accession: | NM_006272.1 |
| Immunogen: | S100B (NP_006263.1, 1 a.a. ~ 92 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Protein accession: | NP_006263.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged S100B is 0.03 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Magnetic bead-quantum dot assay for detection of a biomarker for traumatic brain injury.Kim C, Searson PC. Nanoscale. 2015 Nov 14;7(42):17820-6. |