| Brand:  | Abnova | 
| Reference:  | H00006285-M51 | 
| Product name:  | S100B monoclonal antibody (M51), clone 1D4 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant S100B. | 
| Clone:  | 1D4 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 6285 | 
| Gene name:  | S100B | 
| Gene alias:  | NEF|S100|S100beta | 
| Gene description:  | S100 calcium binding protein B | 
| Genbank accession:  | NM_006272.1 | 
| Immunogen:  | S100B (NP_006263.1, 1 a.a. ~ 92 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 
| Protein accession:  | NP_006263.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (35.86 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged S100B is 0.03 ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA,WB-Re,WB-Tr | 
| Shipping condition:  | Dry Ice |