| Brand:  | Abnova | 
| Reference:  | H00006285-M50 | 
| Product name:  | S100B monoclonal antibody (M50), clone 1B2 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant S100B. | 
| Clone:  | 1B2 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 6285 | 
| Gene name:  | S100B | 
| Gene alias:  | NEF|S100|S100beta | 
| Gene description:  | S100 calcium binding protein B | 
| Genbank accession:  | NM_006272.1 | 
| Immunogen:  | S100B (NP_006263.1, 1 a.a. ~ 92 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 
| Protein accession:  | NP_006263.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (35.86 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to S100B on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] | 
| Applications:  | IHC-P,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Neuronal damage biomarkers in the identification of patients at risk of long-term postoperative cognitive dysfunction after cardiac surgery.Kok WF, Koerts J, Tucha O, Scheeren TW, Absalom AR. Anaesthesia. 2016 Dec 17. [Epub ahead of print] |