Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of S100A12 monoclonal antibody (M01), clone 1F10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about S100A12 monoclonal antibody (M01), clone 1F10
| Brand: | Abnova |
| Reference: | H00006283-M10 |
| Product name: | S100A12 monoclonal antibody (M01), clone 1F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant S100A12. |
| Clone: | 1F10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6283 |
| Gene name: | S100A12 |
| Gene alias: | CAAF1|CAGC|CGRP|ENRAGE|MRP6|p6 |
| Gene description: | S100 calcium binding protein A12 |
| Genbank accession: | NM_005621.1 |
| Immunogen: | S100A12 (NP_005612.1, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE |
| Protein accession: | NP_005612.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged S100A12 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |