| Brand: | Abnova |
| Reference: | H00006282-M17 |
| Product name: | S100A11 monoclonal antibody (M17), clone 1B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant S100A11. |
| Clone: | 1B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6282 |
| Gene name: | S100A11 |
| Gene alias: | MLN70|S100C |
| Gene description: | S100 calcium binding protein A11 |
| Genbank accession: | BC014354 |
| Immunogen: | S100A11 (AAH14354.1, 10 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGL |
| Protein accession: | AAH14354.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged S100A11 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |