Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of S100A11 monoclonal antibody (M01), clone 2F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about S100A11 monoclonal antibody (M01), clone 2F4
| Brand: | Abnova |
| Reference: | H00006282-M01 |
| Product name: | S100A11 monoclonal antibody (M01), clone 2F4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant S100A11. |
| Clone: | 2F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6282 |
| Gene name: | S100A11 |
| Gene alias: | MLN70|S100C |
| Gene description: | S100 calcium binding protein A11 |
| Genbank accession: | BC014354 |
| Immunogen: | S100A11 (AAH14354, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT |
| Protein accession: | AAH14354 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to S100A11 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | S100A expression in normal corneal-limbal epithelial cells and ocular surface squamous cell carcinoma tissue.Li J, Riau AK, Setiawan M, Mehta JS, Ti SE, Tong L, Tan DT, Beuerman RW. Mol Vis. 2011;17:2263-71. Epub 2011 Aug 20. |