| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00006280-M13 |
| Product name: | S100A9 monoclonal antibody (M13), clone 1C22 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant S100A9. |
| Clone: | 1C22 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6280 |
| Gene name: | S100A9 |
| Gene alias: | 60B8AG|CAGB|CFAG|CGLB|L1AG|LIAG|MAC387|MIF|MRP14|NIF|P14 |
| Gene description: | S100 calcium binding protein A9 |
| Genbank accession: | BC047681 |
| Immunogen: | S100A9 (AAH47681, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
| Protein accession: | AAH47681 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of S100A9 expression in transfected 293T cell line by S100A9 monoclonal antibody (M13), clone 1C22. Lane 1: S100A9 transfected lysate(13.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |