Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of S100A9 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about S100A9 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00006280-D01P |
| Product name: | S100A9 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human S100A9 protein. |
| Gene id: | 6280 |
| Gene name: | S100A9 |
| Gene alias: | 60B8AG|CAGB|CFAG|CGLB|L1AG|LIAG|MAC387|MIF|MRP14|NIF|P14 |
| Gene description: | S100 calcium binding protein A9 |
| Genbank accession: | NM_002965.2 |
| Immunogen: | S100A9 (NP_002956.1, 1 a.a. ~ 114 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
| Protein accession: | NP_002956.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | S100A9 MaxPab rabbit polyclonal antibody. Western Blot analysis of S100A9 expression in human spleen. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Methods for predicting rheumatoid arthritis treatment response.Vittecoq O, Lequerre T, Cosette P, Boyer O, Le Loet X, Hardouin J, Obry A. United States Patent Application. 2016 May 05. US20160123992A1 |