| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00006279-B02P |
| Product name: | S100A8 purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human S100A8 protein. |
| Gene id: | 6279 |
| Gene name: | S100A8 |
| Gene alias: | 60B8AG|CAGA|CFAG|CGLA|CP-10|L1Ag|MA387|MIF|MRP8|NIF|P8 |
| Gene description: | S100 calcium binding protein A8 |
| Genbank accession: | NM_002964.3 |
| Immunogen: | S100A8 (NP_002955.2, 1 a.a. ~ 93 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
| Protein accession: | NP_002955.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of S100A8 expression in transfected 293T cell line (H00006279-T04) by S100A8 MaxPab polyclonal antibody. Lane 1: S100A8 transfected lysate(10.80 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |