No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00006273-M03 |
Product name: | S100A2 monoclonal antibody (M03), clone 3H8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant S100A2. |
Clone: | 3H8 |
Isotype: | IgG2b Kappa |
Gene id: | 6273 |
Gene name: | S100A2 |
Gene alias: | CAN19|MGC111539|S100L |
Gene description: | S100 calcium binding protein A2 |
Genbank accession: | BC002829 |
Immunogen: | S100A2 (AAH02829, 1 a.a. ~ 97 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP |
Protein accession: | AAH02829 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to S100A2 on A-431 cell. [antibody concentration 15 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |