| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr | 
| Brand: | Abnova | 
| Reference: | H00006257-M01 | 
| Product name: | RXRB monoclonal antibody (M01), clone 3C8 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RXRB. | 
| Clone: | 3C8 | 
| Isotype: | IgG2b Kappa | 
| Gene id: | 6257 | 
| Gene name: | RXRB | 
| Gene alias: | DAUDI6|H-2RIIBP|MGC1831|NR2B2|RCoR-1 | 
| Gene description: | retinoid X receptor, beta | 
| Genbank accession: | BC001167 | 
| Immunogen: | RXRB (AAH01167.1, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | QINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYC | 
| Protein accession: | AAH01167.1 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Western Blot analysis of RXRB expression in transfected 293T cell line by RXRB monoclonal antibody (M01), clone 3C8. Lane 1: RXRB transfected lysate(56.9 KDa). Lane 2: Non-transfected lysate.  | 
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr | 
| Shipping condition: | Dry Ice |