| Brand:  | Abnova | 
| Reference:  | H00006240-M08 | 
| Product name:  | RRM1 monoclonal antibody (M08), clone 2D11 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant RRM1. | 
| Clone:  | 2D11 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 6240 | 
| Gene name:  | RRM1 | 
| Gene alias:  | R1|RIR1|RR1 | 
| Gene description:  | ribonucleotide reductase M1 | 
| Genbank accession:  | NM_001033.2 | 
| Immunogen:  | RRM1 (NP_001024.1, 593 a.a. ~ 792 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS | 
| Protein accession:  | NP_001024.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (47.41 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human,Mouse | 
| Application image:  |   | 
| Application image note:  | RRM1 monoclonal antibody (M08), clone 2D11. Western Blot analysis of RRM1 expression in K-562. | 
| Applications:  | WB-Ce,ELISA,WB-Re,WB-Tr | 
| Shipping condition:  | Dry Ice |