Brand: | Abnova |
Reference: | H00006233-M02 |
Product name: | RPS27A monoclonal antibody (M02), clone 2G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS27A. |
Clone: | 2G10 |
Isotype: | IgG2a Kappa |
Gene id: | 6233 |
Gene name: | RPS27A |
Gene alias: | CEP80|HUBCEP80|UBA80|UBCEP1|UBCEP80 |
Gene description: | ribosomal protein S27a |
Genbank accession: | NM_002954 |
Immunogen: | RPS27A (NP_002945.1, 57 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK |
Protein accession: | NP_002945.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RPS27A is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |