Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RPS27A monoclonal antibody (M01), clone 3E2-E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about RPS27A monoclonal antibody (M01), clone 3E2-E6
| Brand: | Abnova |
| Reference: | H00006233-M01 |
| Product name: | RPS27A monoclonal antibody (M01), clone 3E2-E6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RPS27A. |
| Clone: | 3E2-E6 |
| Isotype: | IgG1 Lambda |
| Gene id: | 6233 |
| Gene name: | RPS27A |
| Gene alias: | CEP80|HUBCEP80|UBA80|UBCEP1|UBCEP80 |
| Gene description: | ribosomal protein S27a |
| Genbank accession: | BC001392 |
| Immunogen: | RPS27A (AAH01392, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK |
| Protein accession: | AAH01392 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RPS27A monoclonal antibody (M01), clone 3E2-E6 Western Blot analysis of RPS27A expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The HBx protein of hepatitis B virus regulates the expression, intracellular distribution and functions of Ribosomal Protein S27a.Fatima G, Mathan G, Kumar V. J Gen Virol. 2011 Dec 7. |