| Brand:  | Abnova | 
| Reference:  | H00006218-M01A | 
| Product name:  | RPS17 monoclonal antibody (M01A), clone 2C7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant RPS17. | 
| Clone:  | 2C7 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 6218 | 
| Gene name:  | RPS17 | 
| Gene alias:  | DBA4|MGC72007|RPS17L1|RPS17L2 | 
| Gene description:  | ribosomal protein S17 | 
| Genbank accession:  | NM_001021 | 
| Immunogen:  | RPS17 (NP_001012, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGPV | 
| Protein accession:  | NP_001012 | 
| Storage buffer:  | In ascites fluid | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human,Mouse,Rat | 
| Application image:  |   | 
| Application image note:  | RPS17 monoclonal antibody (M01A), clone 2C7 Western Blot analysis of RPS17 expression in HeLa ( Cat # L013V1 ). | 
| Applications:  | WB-Ce,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |