| Brand: | Abnova |
| Reference: | H00006205-M03 |
| Product name: | RPS11 monoclonal antibody (M03), clone 2A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS11. |
| Clone: | 2A5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6205 |
| Gene name: | RPS11 |
| Gene alias: | - |
| Gene description: | ribosomal protein S11 |
| Genbank accession: | NM_001015 |
| Immunogen: | RPS11 (NP_001006, 59 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF |
| Protein accession: | NP_001006 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RPS11 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |