| Brand: | Abnova |
| Reference: | H00006199-A01 |
| Product name: | RPS6KB2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RPS6KB2. |
| Gene id: | 6199 |
| Gene name: | RPS6KB2 |
| Gene alias: | KLS|P70-beta|P70-beta-1|P70-beta-2|S6K-beta2|S6K2|SRK|STK14B|p70(S6K)-beta|p70S6Kb |
| Gene description: | ribosomal protein S6 kinase, 70kDa, polypeptide 2 |
| Genbank accession: | BC006106 |
| Immunogen: | RPS6KB2 (AAH06106, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV |
| Protein accession: | AAH06106 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |