Brand: | Abnova |
Reference: | H00006198-M04 |
Product name: | RPS6KB1 monoclonal antibody (M04), clone 4H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS6KB1. |
Clone: | 4H4 |
Isotype: | IgG1 Kappa |
Gene id: | 6198 |
Gene name: | RPS6KB1 |
Gene alias: | PS6K|S6K|S6K1|STK14A|p70(S6K)-alpha|p70-S6K|p70-alpha |
Gene description: | ribosomal protein S6 kinase, 70kDa, polypeptide 1 |
Genbank accession: | NM_003161 |
Immunogen: | RPS6KB1 (NP_003152, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL |
Protein accession: | NP_003152 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | RPS6KB1 monoclonal antibody (M04), clone 4H4 Western Blot analysis of RPS6KB1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |